PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00089.17
Common NameAMTR_s00089p00057120, LOC18429914
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family G2-like
Protein Properties Length: 292aa    MW: 32022.4 Da    PI: 6.8549
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00089.17genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.12.3e-343993155
                                  G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                             kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQkYRl
  evm_27.model.AmTr_v1.0_scaffold00089.17 39 KPRLRWTAELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKYRL 93
                                             79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.0953696IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-333694IPR009057Homeodomain-like
SuperFamilySSF466891.67E-173896IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-243994IPR006447Myb domain, plants
PfamPF002498.6E-94192IPR001005SANT/Myb domain
PfamPF143796.8E-27130176IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009567Biological Processdouble fertilization forming a zygote and endosperm
GO:0010628Biological Processpositive regulation of gene expression
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MYSAFHSLEK GLGREDLQGA LEGTNLPGDA CLVLTTDPKP RLRWTAELHE RFVDAVTQLG  60
GPDKATPKTI MRTMGVKGLT LYHLKSHLQK YRLGKQSCKE FTDNSKEESQ GTTSSSSSKL  120
ASQDMNEGYQ VTEALRVHME VQRRLHEQLE VQKHLQLRIE AQGKYLQSIL EKACKALADQ  180
TVASAGLEAA RQELSALVIK VSNGCLSAPS EFLNLPILPE MASVCVDDKK LNRQAQMADC  240
SADSCATSNE SSAGAPLQSG GKKRLRPMYC EGDSLVWEGE ARQDPQWMTP L*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006840145.10.0PREDICTED: myb family transcription factor APL
SwissprotQ9SAK51e-70APL_ARATH; Myb family transcription factor APL
TrEMBLW1P4D70.0W1P4D7_AMBTC; Uncharacterized protein
STRINGVIT_05s0029g00060.t011e-128(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.11e-107G2-like family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]